Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0418000_circ_g.1 |
| ID in PlantcircBase | osa_circ_033518 |
| Alias | Os07circ06526/Os_ciR10877 |
| Organism | Oryza sativa |
| Position | chr7: 13288292-13289781 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl, find_circ |
| Parent gene | Os07g0418000 |
| Parent gene annotation |
Similar to predicted protein. (Os07t0418000-01);HAD-like domain domain containing protein. (Os07t0418000-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0418000_circ_g.2 Os07g0418000_circ_g.3 |
| Support reads | 4/2 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0418000-01:2 Os07t0418000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202893674 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13288369-13288296(+) 13288310-13289773(-) 13289749-13289773(-) 13288338-13288362(-) |
| Potential amino acid sequence |
MKCQALMLWHLLQLLENFYLWTR*(+) MEPLPGPKVKVLQQLQQMPQHQGLTLHFVEDRLATLKNVIKEPALDQWNLYLVQR*(-) MPQHQGLTLHFVEDRLATLKNVIKEPALDQWNLYLVQR*(-) MSLKSQHWTNGTSTWSKGKSSPATAANATASRPDTSFR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015 |