Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0252800_circ_g.2 |
| ID in PlantcircBase | osa_circ_038588 |
| Alias | Os_ciR4167 |
| Organism | Oryza sativa |
| Position | chr9: 4032088-4032728 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0252800 |
| Parent gene annotation |
HECT domain containing protein. (Os09t0252800-01);Similar to pre dicted protein. (Os09t0252800-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0252800_circ_g.1 Os09g0252800_circ_g.3 Os09g0252800_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0252800-02:3 Os09t0252800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.23112097 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4032227-4032104(+) |
| Potential amino acid sequence |
MLENDVSDIPDLTFSMDPDEEKHILYEKNEVTDYELKPGGRNIRVTEETKHEYVDLVAEHILTT AIRPQINAFLEGFTELVPRELISLFHDKELELLISGLPEIDCCQSLI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |