Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0586800_circ_g.10 |
| ID in PlantcircBase | osa_circ_020567 |
| Alias | Os_ciR8657 |
| Organism | Oryza sativa |
| Position | chr3: 21672426-21672948 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os03g0586800 |
| Parent gene annotation |
Similar to Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA liga se) (LysRS). (Os03t0586800-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0586800_circ_g.6 Os03g0586800_circ_g.7 Os03g0586800_circ_g.8 Os03g0586800_circ_g.9 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0586800-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.237327948 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21672887-21672726(-) 21672476-21672928(-) |
| Potential amino acid sequence |
MDPTQYYENRLKALDSLKATGVNPYPHKFLANITVADYIEKYKSMNVGDKLVDVTECLAGRIMT KRAQSSKLLFYDLYGGGEKVQVFADARPLQQQLLVESPRRNLPPTMRKWIPLNIMRIASRHLIH SRPRV*(-) MIFMVVVRKFKFLLMPGRCNSSC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |