Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G057100_circ_g.1 |
| ID in PlantcircBase | gra_circ_001091 |
| Alias | Chr10:6469029|6469682 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 6469029-6469682 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G057100 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.010G057100.4:2 Gorai.010G057100.5:1 Gorai.010G057100.1:2 Gorai.010G057100.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104995005 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6469449-6469666(-) 6469378-6469613(-) 6469616-6469093(+) |
| Potential amino acid sequence |
MLLQQLRQVLLIKGCFYLICFIRSCHTYLSMRVHNEVLPKKQLLLPRLTSLVPGIHADQMTLNK IHRTRNVRRFITEC*(-) MPYISQHAGSQRSTPEEATTSAPADLSSTGNSRRPNDTEQNPPNSKRQKVHYRMLIQDNRSVLI HAVSISAF*(-) MLILTLRVLGRSCCLELAFGNEPSDVSSSVDFVQCHLVCVNSRY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |