Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G115300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000467 |
| Alias | Chr05:22540932|22541356 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 22540932-22541356 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G115300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/21 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G115300.1:1 Gorai.005G115300.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.978773176 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22541076-22541338(-) 22541303-22540976(+) |
| Potential amino acid sequence |
MKYSGPEVNSMTHLSNSKGLSARTNRVKLRNLLAAVEGADLLKATQLKQRRYQG*(-) MDTHHNLIAFFLPLIPSLLQLCSFQEISTLYSS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |