Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A03G1543_circ_g.1 |
| ID in PlantcircBase | ghi_circ_000368 |
| Alias | ghi_circ_000069_byXiang |
| Organism | Gossypium hirsutum |
| Position | chrA03: 96187460-96188124 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Gh_A03G1543 |
| Parent gene annotation |
SIMILAR TO: AT5G64300, GTP cyclohydrolase II |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 14/9 |
| Tissues | root/stem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gh_A03G1543:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
96187519-96187462(+) 96187992-96187462(+) |
| Potential amino acid sequence |
MWGPFTAHCYRSILDGIEHIAMVKGEIGDGQDILVRVHSECLTGDIFGSARCDCGNQLGLAMKQ IEAAGRGVLVYLRGHEGRGIGLGHKLRAYNLQDAGRDTVEANVELGLPVDSREYGIGAQV*(+) MKAGELVWATSFVHIIFRTLVVTQSKQMWNLDCPLIQENMALAHRYRRKRDKLIELAGAARIPT MWGPFTAHCYRSILDGIEHIAMVKGEIGDGQDILVRVHSECLTGDIFGSARCDCGNQLGLAMKQ IEAAGRGVLVYLRGHEGRGIGLGHKLRAYNLQDAGRDTVEANVELGLPVDSREYGIGAQV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Xiang et al., 2018 |