Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0218200_circ_g.2 |
| ID in PlantcircBase | osa_circ_013885 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 6605725-6605802 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0218200 |
| Parent gene annotation |
Peptidase M1, membrane alanine aminopeptidase family protein. (O s02t0218200-01);Similar to APM1 (AMINOPEPTIDASE M1). (Os02t02182 00-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0218200-02:1 Os02t0218200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216883013 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6605780-6605727(-) |
| Potential amino acid sequence |
MSRCTDSSKQKYRVLIPHLQPCPCHLMSRCTDSSKQKYRVLIPHLQPCPCHLMSRCTDSSKQKY RVLIPHLQPCPCHLMSRCTDSSKQKYRVLIPH(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |