Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G079800_circ_g.2 |
| ID in PlantcircBase | gra_circ_000046 |
| Alias | Chr01:8364800|8365121 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 8364800-8365121 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G079800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 25 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G079800.6:2 Gorai.001G079800.5:2 Gorai.001G079800.2:2 Gorai.001G079800.1:2 Gorai.001G079800.3:2 Gorai.001G079800.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000047 |
| PMCS | 0.563487371 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8364842-8364842(+) |
| Potential amino acid sequence |
MIEALFKHTTCLLTSIKEFTRRPDIGDDCFLLASRCIRYCPQLFIPSSIFPALVDCAMIGITVQ HRYLALILLVQATSKI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |