Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003166_circ_g.2 |
ID in PlantcircBase | zma_circ_007135 |
Alias | zma_circ_0001021, GRMZM2G160801_C1 |
Organism | Zea mays |
Position | chr2: 34273068-34273378 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d003166 |
Parent gene annotation |
LETM1-like protein |
Parent gene strand | + |
Alternative splicing | Zm00001d003166_circ_g.1 Zm00001d003166_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d003166_T009:2 Zm00001d003166_T013:2 Zm00001d003166_T018:2 Zm00001d003166_T004:2 Zm00001d003166_T003:2 Zm00001d003166_T014:2 Zm00001d003166_T016:2 Zm00001d003166_T011:2 Zm00001d003166_T012:2 Zm00001d003166_T007:2 Zm00001d003166_T017:2 Zm00001d003166_T006:2 Zm00001d003166_T005:2 Zm00001d003166_T002:2 Zm00001d003166_T015:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.343739508 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34273230-34273375(+) 34273276-34273119(+) |
Potential amino acid sequence |
MKPEEAVVATLSSLPDEVVDTVGTVLPSEDSVSERKRKLEFLEMQEELIKLRDWLDLSLNHSVP SSLLILSRAFTVSGKMKPEEAVVATLSSLPDEVVDTVGTVLPSEDSVSERKRKLEFLEMQEELI KLRDWLDLSLNHSVPSSLLILSRAFTVSGKMKPEEAVVATLSSLPDEVVDTVGTVLPSEDSVSE RKRKLEFLEMQEELIKLRDWLDLSLNHSVPSSLLILSRAFTVSGKMKPEEAVVATLSSLPDEVV DTVGTVLPSEDSVSERKRKLEFLEMQEELIK(+) MKLSIQLGLYCLLKILFQRGRENWNFWRCRKSLSSSETGWIYHSIILCHRLF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |