Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G05940_circ_g.2 |
| ID in PlantcircBase | ath_circ_000907 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 1802646-1802870 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G05940 |
| Parent gene annotation |
Cationic amino acid transporter 9, chloroplastic |
| Parent gene strand | - |
| Alternative splicing | AT1G05940_circ_g.1 |
| Support reads | 9 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G05940.2:1 AT1G05940.4:1 AT1G05940.1:1 AT1G05940.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.521838371 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1802850-1802648(-) |
| Potential amino acid sequence |
MGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGMKFVSILISIGAVAGLTTTLLVG LYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGMKFVSILISIGA VAGLTTTLLVGLYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGM KFVSILISIGAVAGLTTTLLVGLYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDA PLAEAFSSKGMKFVSILISIGAVAGLTTTLLVGLYVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |