Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G05940_circ_g.2 |
ID in PlantcircBase | ath_circ_000907 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 1802646-1802870 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT1G05940 |
Parent gene annotation |
Cationic amino acid transporter 9, chloroplastic |
Parent gene strand | - |
Alternative splicing | AT1G05940_circ_g.1 |
Support reads | 9 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G05940.2:1 AT1G05940.4:1 AT1G05940.1:1 AT1G05940.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.521838371 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1802850-1802648(-) |
Potential amino acid sequence |
MGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGMKFVSILISIGAVAGLTTTLLVG LYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGMKFVSILISIGA VAGLTTTLLVGLYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDAPLAEAFSSKGM KFVSILISIGAVAGLTTTLLVGLYVQRDLPIGIMGSLLVCISLYIGVCLVLTGMVPFSLLSEDA PLAEAFSSKGMKFVSILISIGAVAGLTTTLLVGLYVQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |