Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G228000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000533 |
| Alias | Chr05:61091500|61092208 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 61091500-61092208 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G228000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G228000.2:3 Gorai.005G228000.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120262494 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61091529-61091529(+) |
| Potential amino acid sequence |
MKINKKGLLESNPSYDAIQAKTGNPPVMPAVMTPGGPLDLSTVLFRNRIIFIGQPVNSQVAQRV ISQLVTLATVDENADILVYLNCPGGSTYSVLAIYDCMSWGYLVELLGFL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |