Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G040700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000324 |
| Alias | Chr04:3494560|3494968 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 3494560-3494968 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G040700 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G040700.2:2 Gorai.004G040700.1:2 Gorai.004G040700.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000984* gar_circ_000529* |
| PMCS | 1.109434311 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3494955-3494641(+) 3494923-3494576(+) 3494831-3494595(+) |
| Potential amino acid sequence |
MFSSTISTLVVASLSSCNNGQDGEFCFQPRLT*(+) MESNPSLQTCKCSPQLFPHWW*(+) MGFQYSQNLAASNTLHLSNAMRITENDTNLRWSQTLLCKLVNVLLNYFHTGGSFFVFL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |