Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G08530_circ_g.18 |
| ID in PlantcircBase | ath_circ_020446 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2591797-2592344 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G08530 |
| Parent gene annotation |
Clathrin heavy chain 2 |
| Parent gene strand | - |
| Alternative splicing | AT3G08530_circ_g.15 AT3G08530_circ_g.16 AT3G08530_circ_g.17 AT3G08530_circ_g.19 AT3G08530_circ_g.20 AT3G08530_circ_g.21 AT3G08530_circ_g.22 AT3G08530_circ_g.23 AT3G08530_circ_g.24 AT3G08530_circ_g.25 AT3G08530_circ_g.26 AT3G08530_circ_g.27 AT3G08530_circ_g.28 AT3G08530_circ_g.29 AT3G08530_circ_g.30 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G08530.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.228282952 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2592072-2591799(-) |
| Potential amino acid sequence |
MMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVGYTPDYLFLLQTI LRTDPQGAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKV GYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLK PNLPEHAFLQTKVGYTPDYLFLLQTILRTDPQGAVNFALMMSQMEGGSPVDYNTITDLFLQRNL IREATSFLLDVLKPNLPEHAFLQTK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |