Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0607400_circ_g.10 |
| ID in PlantcircBase | osa_circ_002535 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 23941169-23941286 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0607400 |
| Parent gene annotation |
Similar to STYLOSA protein. (Os01t0607400-01);Similar to STYLOSA protein. (Os01t0607400-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0607400_circ_g.1 Os01g0607400_circ_g.2 Os01g0607400_circ_g.3 Os01g0607400_circ_g.4 Os01g0607400_circ_g.5 Os01g0607400_circ_g.6 Os01g0607400_circ_g.7 Os01g0607400_circ_g.8 Os01g0607400_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0607400-02:1 Os01t0607400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.349470551 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23941254-23941221(+) 23941263-23941284(-) |
| Potential amino acid sequence |
MNHLLANDPRQPLLASMERPNESLGSMSS*(+) MVHWMKMLNLFYLRMTWTLGIHWGAPWMLVKADVDRLLEDGSLDENVESFLSQDDMDPRDSLGR SMDASKG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |