Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0837800_circ_g.3 |
| ID in PlantcircBase | osa_circ_004767 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 35918898-35920358 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0837800 |
| Parent gene annotation |
Metal tolerance protein, Manganese transporter, Mn-cation diffus ion facilitator (CDF ), Mn and other heavy metal tolerance and h omeostasis (Os01t0837800-01);Similar to metal tolerance protein. (Os01t0837800-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0837800_circ_g.4 Os01g0837800_circ_g.5 Os01g0837800_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0837800-02:4 Os01t0837800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.294162948 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35920310-35920340(-) |
| Potential amino acid sequence |
MLEGFNEMDTLTDRGFLPGMSKEEREKVARSETLAIRLSNIANMVLFAAKVYASVRSGSLAIIA STLDSLLDLLSGFILWFTAFSMQTPNPYRYPIGKKRMQPLGILVFASVMATLGLQIILESVRSL LSDGDEFSLTKEQEKWVVDIMLAVTLVKLALVLYCRTFTNEIVKAYAQDHFFDVITNMIGLVAA LLATYIEGWIDPVGAIILKVLRT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |