Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0142900_circ_g.3 |
ID in PlantcircBase | osa_circ_032748 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 2195706-2196443 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0142900 |
Parent gene annotation |
Aldo/keto reductase family protein. (Os07t0142900-01) |
Parent gene strand | + |
Alternative splicing | Os07g0142900_circ_ag.1 Os07g0142900_circ_g.2 Os07g0142900_circ_g.3 Os07g0142900_circ_g.4 Os07g0142900_circ_ag.5 Os07g0142900_circ_g.6 Os07g0142900_circ_g.7 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0142900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007017* osi_circ_017290 |
PMCS | 0.244893552 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2196425-2195799(+) 2195736-2195735(+) 2195728-2196176(-) |
Potential amino acid sequence |
MGRTQPRETPSGCICADEEKRSSTCCKPSELQPNIQDS*(+) MKKRGVPLAANQVNYSLIYRTPELNGVKAACDELGITLIAYSPIAQGVLSGKYTPEKPPTGPRA NTYTPEFLTKLQPLMNRIKEIGESYGKNPTQRNAFGMHMRG*(+) MHPEGVSLGWVLPIAFSNLLDPVHEWLKLGEELRGICVCSRTGRRFFWSVFS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |