Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0142900_circ_g.3 |
| ID in PlantcircBase | osa_circ_032748 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 2195706-2196443 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0142900 |
| Parent gene annotation |
Aldo/keto reductase family protein. (Os07t0142900-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0142900_circ_ag.1 Os07g0142900_circ_g.2 Os07g0142900_circ_g.3 Os07g0142900_circ_g.4 Os07g0142900_circ_ag.5 Os07g0142900_circ_g.6 Os07g0142900_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0142900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007017* osi_circ_017290 |
| PMCS | 0.244893552 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2196425-2195799(+) 2195736-2195735(+) 2195728-2196176(-) |
| Potential amino acid sequence |
MGRTQPRETPSGCICADEEKRSSTCCKPSELQPNIQDS*(+) MKKRGVPLAANQVNYSLIYRTPELNGVKAACDELGITLIAYSPIAQGVLSGKYTPEKPPTGPRA NTYTPEFLTKLQPLMNRIKEIGESYGKNPTQRNAFGMHMRG*(+) MHPEGVSLGWVLPIAFSNLLDPVHEWLKLGEELRGICVCSRTGRRFFWSVFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |