Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G38010_circ_g.3 |
ID in PlantcircBase | ath_circ_017148 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15908906-15909228 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G38010 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | AT2G38010_circ_g.2 |
Support reads | 2 |
Tissues | inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G38010.2:2 AT2G38010.1:2 AT2G38010.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158284056 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15909070-15909225(+) |
Potential amino acid sequence |
MAGRRLRDAIKSFLISSDPKEFSNNMHVVIAGLTNTYSQYIATFEEYEVQRYEPSILPIQILRI GQLVILSVPGEFTTMAGRRLRDAIKSFLISSDPKEFSNNMHVVIAGLTNTYSQYIATFEEYEVQ RYEPSILPIQILRIGQLVILSVPGEFTTMAGRRLRDAIKSFLISSDPKEFSNNMHVVIAGLTNT YSQYIATFEEYEVQRYEPSILPIQILRIGQLVILSVPGEFTTMAGRRLRDAIKSFLISSDPKEF SNNMHVVIAGLTNTYSQYIATFEEYEVQRYE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |