Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0212700_circ_g.4 |
| ID in PlantcircBase | osa_circ_041273 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5873245-5873504 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os03g0212700 |
| Parent gene annotation |
Similar to Cytochrome C reductase-processing peptidase subunit I , MPP subunit I, P55. (Os03t0212700-01);Similar to mitochondrial -processing peptidase beta subunit. (Os03t0212700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0212700-01:2 Os03t0212700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.241816314 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5873260-5873407(-) |
| Potential amino acid sequence |
MEDFSWSKMKRLATRLTVLASTASILAKSSGIGILRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |