Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G038700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000919 |
| Alias | Chr09:2843991|2844322 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 2843991-2844322 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G038700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.009G038700.2:1 Gorai.009G038700.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.100461245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2844015-2844063(+) 2844202-2844010(+) 2844022-2844218(-) |
| Potential amino acid sequence |
MPSEAHVHCYTHRQGSLTISVKKLPDPPLPGEREGKIWMWHRCLRCPRTNGFPPATRRVVMSDA AWGLSFGKFLELSFSNHAAASRVASCGHSLHRDCLRFYGAPVVVHVRCHLRHMFIVILIGKVA* (+) MLLGAYPSGNFWSLAFLTMQLLAELQAVVIPFTEIVFDFMELPLSFM*(+) MASHMNDNGSSIKSKTISVKGMTTACNSASSCMVRKAKLQKFPEG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |