Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa1G123490_circ_g.1 |
| ID in PlantcircBase | csa_circ_000279 |
| Alias | Chr1:9194052_9196412 |
| Organism | Cucumis sativus |
| Position | chrChr1: 9194052-9196412 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa1G123490 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | Csa1G123490_circ_g.7 Csa1G123490_circ_g.8 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa1G123490.1:2 Csa1G123490.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.095610546 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9196298-9196409(+) 9194112-9194053(+) |
| Potential amino acid sequence |
MGNSISDPTGNCVWCKLEKASLDIDPNACLICKVGGKLLLGNDSLKDFCSCVEIDQQQNETISI DVDRGKSMGNSISDPTGNCVWCKLEKASLDIDPNACLICKVGGKLLLGNDSLKDFCSCVEIDQQ QNETISIDVDRGKSMGNSISDPTGNCVWCKLEKASLDIDPNACLICKVGGKLLLGNDSLKDFCS CVEIDQQQNETISIDVDRGKSMGNSISDPTGNCVWCKLEKASLDIDPNACLICKVGGKL MKQYLLMWIEGSPWAIPSQILLEIVFGVSWKKHPWTSTQMHASSAKLGENSC* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |