Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0286300_circ_g.2 |
ID in PlantcircBase | osa_circ_019251 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 9874207-9874310 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os03g0286300 |
Parent gene annotation |
Similar to Phosphate/phosphoenolpyruvate translocator protein-li ke. (Os03t0286300-01);Similar to organic anion transporter. (Os0 3t0286300-02) |
Parent gene strand | + |
Alternative splicing | Os03g0286300_circ_g.3 |
Support reads | 2 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0286300-01:1 Os03t0286300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.41904351 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9874241-9874270(+) 9874226-9874223(-) |
Potential amino acid sequence |
MCIGATAARALKTVLQGILLSSEGESLAFICLDSSCALGPLLQGH*(+) MKARLSPSDERRIPCNTVFNALAAVAPMHMMNPNR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |