Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d004707_circ_g.6 |
ID in PlantcircBase | zma_circ_007272 |
Alias | Zm02circ00080, zma_circ_0000806, ZmciR99 |
Organism | Zea mays |
Position | chr2: 132451105-132451393 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d004707 |
Parent gene annotation |
thylakoid assembly1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d004707_T015:2 Zm00001d004707_T001:2 Zm00001d004707_T012:2 Zm00001d004707_T004:2 Zm00001d004707_T014:2 Zm00001d004707_T010:2 Zm00001d004707_T003:2 Zm00001d004707_T002:2 Zm00001d004707_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.335917149 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
132451130-132451107(-) |
Potential amino acid sequence |
MTGTAKTELTGRVEPKRRWSDGIHQAVEAKEGLKIQADSVIVAQITYQSLFKLYPKLSGMTGTA KTELTGRVEPKRRWSDGIHQAVEAKEGLKIQADSVIVAQITYQSLFKLYPKLSGMTGTAKTELT GRVEPKRRWSDGIHQAVEAKEGLKIQADSVIVAQITYQSLFKLYPKLSGMTGTAKTE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |