Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g043420.2_circ_g.6 |
| ID in PlantcircBase | sly_circ_002330 |
| Alias | 7:54503901|54504166, Slcirc107 |
| Organism | Solanum lycopersicum |
| Position | chr7: 57180401-57180666 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc07g043420.2 |
| Parent gene annotation |
Putative uncharacterized protein |
| Parent gene strand | + |
| Alternative splicing | Solyc07g043420.2_circ_g.1 Solyc07g043420.2_circ_g.2 Solyc07g043420.2_circ_g.3 Solyc07g043420.2_circ_g.4 Solyc07g043420.2_circ_g.5 Solyc07g043420.2_circ_g.7 Solyc07g043420.2_circ_g.8 Solyc07g043420.2_circ_g.9 Solyc07g043420.2_circ_g.10 Solyc07g043420.2_circ_g.11 |
| Support reads | 125/460 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc07g043420.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.18574215 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57180432-57180401(+) 57180496-57180435(+) 57180414-57180585(-) |
| Potential amino acid sequence |
MDEAMKVYKEFFSLPAEEKENYAKDAANNTNRGAATLYSSSAKHYDSEEHRYWRDVLEHSCNLD GEDKKTWPDNPPRYR*(+) MQKMQLIIPIGVQLHCTVAVLSIMIQRSIVTGEMCWNIAAILMEKTKKLGPITLQDIDNQSWST CRSNG*(+) MIDYLYLGGLSGQVFLSSPSRLQLCSNTSLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018; Wang et al., 2018b |