Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G124600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000474 |
| Alias | Chr05:27853782|27854346 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 27853782-27854346 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G124600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G124600.3:3 Gorai.005G124600.1:3 Gorai.005G124600.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147491947 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27853843-27854344(-) 27853833-27854344(-) |
| Potential amino acid sequence |
MVGNVNTSNALSAFEKMEEKG*(-) MSTQAMLYQLLRKWKRKDNASSLKAQLDQQKSVVENLVSNTRLLESKIQEAKSKKDTLKARAQT ARTATKVNEMVGNVNTSNALSAFEKMEEKG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |