Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa1G422430_circ_g.1 |
| ID in PlantcircBase | csa_circ_000376 |
| Alias | Chr1:15311390_15312433 |
| Organism | Cucumis sativus |
| Position | chrChr1: 15311390-15312433 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa1G422430 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa1G422430.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.273168239 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15312126-15311398(+) |
| Potential amino acid sequence |
MVVRDSQKLRSILGSGMSNKMWEALLEHAKTCVLSGKLHIYYPEEARNVGVVFNNIYELNGLIT GEQYFPADSLSDSQKVVS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |