Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G03640_circ_g.1 |
ID in PlantcircBase | ath_circ_012693 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 1104969-1105034 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT2G03640 |
Parent gene annotation |
Nuclear transport factor 2 (NTF2) family protein with RNA bindin g (RRM-RBD-RNP motifs) domain-containing protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G03640.3:1 AT2G03640.4:1 AT2G03640.5:1 AT2G03640.2:1 AT2G03640.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1105004-1105031(+) |
Potential amino acid sequence |
MPQTQYSSFFPERHFLLLHHFRMPQTQYSSFFPERHFLLLHHFRMPQTQYSSFFPERHFLLLHH FRMPQTQYSSFF(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |