Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G03640_circ_g.1 |
| ID in PlantcircBase | ath_circ_012693 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 1104969-1105034 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT2G03640 |
| Parent gene annotation |
Nuclear transport factor 2 (NTF2) family protein with RNA bindin g (RRM-RBD-RNP motifs) domain-containing protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G03640.3:1 AT2G03640.4:1 AT2G03640.5:1 AT2G03640.2:1 AT2G03640.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1105004-1105031(+) |
| Potential amino acid sequence |
MPQTQYSSFFPERHFLLLHHFRMPQTQYSSFFPERHFLLLHHFRMPQTQYSSFFPERHFLLLHH FRMPQTQYSSFF(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |