Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0154700_circ_g.7 |
| ID in PlantcircBase | osa_circ_026628 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 3206415-3207077 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0154700 |
| Parent gene annotation |
Kinesin 13 protein, Regulation of grain length and plant height (Os05t0154700-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0154700_circ_g.2 Os05g0154700_circ_g.3 Os05g0154700_circ_g.4 Os05g0154700_circ_g.5 Os05g0154700_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0154700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196580769 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3206936-3206448(+) 3207042-3206915(+) 3206442-3207025(-) 3206987-3207029(-) |
| Potential amino acid sequence |
MQPLPLRAAQDMVRLLHQPVYRNQNFKLWLSYFEIYGGKLFDLLSDRRYTARLWSPLYQ*(+) MVGSSLIFSLIEGIPRDCGAHYTNNIPKNKSNMFCLWSNR*(+) MGSTVSRYTFYQREDQRASHHISQSS*(-) MQKANHVLCSSQRQRLHRICLATTCLTISKTCCFCSLEYYWYNGLHSLAVYLLSERRSKSFPPY ISK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |