Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0223400_circ_g.1 |
ID in PlantcircBase | osa_circ_033237 |
Alias | Os_ciR11305 |
Organism | Oryza sativa |
Position | chr7: 6824304-6825005 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0223400 |
Parent gene annotation |
Similar to ADP-ribosylation factor 1. (Os07t0223400-01) |
Parent gene strand | + |
Alternative splicing | Os07g0223100_circ_ag.1 Os07g0223100_circ_ag.2 Os07g0223100_circ_ag.3 Os07g0223100_circ_ag.4 Os07g0223100_circ_ag.5 Os07g0223100_circ_ag.6 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0223400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | ath_circ_009467 |
PMCS | 0.587702737 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6824952-6824313(+) 6824689-6824313(+) 6824602-6824965(-) |
Potential amino acid sequence |
MLLRLLISLDYIPFVSVTGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWVQC*(+ ) MLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWVQC*(+) MPPKRSDLVLTPHIPDSEANVLVLNSFNIEPSDADEGNVIQAYQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |