Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0111600_circ_g.5 |
ID in PlantcircBase | osa_circ_029370 |
Alias | Os_ciR10773 |
Organism | Oryza sativa |
Position | chr6: 653401-654241 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0111600 |
Parent gene annotation |
AMP-dependent synthetase/ligase domain containing protein. (Os06 t0111600-01) |
Parent gene strand | + |
Alternative splicing | Os06g0111600_circ_g.3 Os06g0111600_circ_g.4 Os06g0111600_circ_g.6 |
Support reads | 2/2 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0111600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017810 |
PMCS | 0.165316191 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
653508-653412(+) 654223-653412(+) 653424-654179(-) |
Potential amino acid sequence |
MTHNMIYVASTSGLVTAISLEVSSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNS HGSVVWKVWLL*(+) MALSFGRCGSYDHHLYALNYKDRCCTYKISCGGSIYGSPAIDMTHNMIYVASTSGLVTAISLEV SSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNSHGSVVWKVWLL*(+) MVVIRATPSKRQSHVSSMQSPDHSPGSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |