Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0111600_circ_g.5 |
| ID in PlantcircBase | osa_circ_029370 |
| Alias | Os_ciR10773 |
| Organism | Oryza sativa |
| Position | chr6: 653401-654241 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0111600 |
| Parent gene annotation |
AMP-dependent synthetase/ligase domain containing protein. (Os06 t0111600-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0111600_circ_g.3 Os06g0111600_circ_g.4 Os06g0111600_circ_g.6 |
| Support reads | 2/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0111600-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017810 |
| PMCS | 0.165316191 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
653508-653412(+) 654223-653412(+) 653424-654179(-) |
| Potential amino acid sequence |
MTHNMIYVASTSGLVTAISLEVSSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNS HGSVVWKVWLL*(+) MALSFGRCGSYDHHLYALNYKDRCCTYKISCGGSIYGSPAIDMTHNMIYVASTSGLVTAISLEV SSFKIIWQYEAGAPIFGSLAIHHHGGKVICCLVNGLVIALNSHGSVVWKVWLL*(+) MVVIRATPSKRQSHVSSMQSPDHSPGSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |