Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0230100_circ_g.6 |
| ID in PlantcircBase | osa_circ_010882 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 7097615-7098346 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os12g0230100 |
| Parent gene annotation |
Similar to ATP-dependent Clp protease ATP-binding subunit clpA h omolog, chloroplast precursor (Fragment). (Os12t0230100-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0230100_circ_g.7 Os12g0230100_circ_g.8 Os12g0230100_circ_g.9 Os12g0230100_circ_g.10 Os12g0230100_circ_g.11 |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0230100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230696243 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7098309-7097829(+) 7098235-7098137(+) 7098290-7097658(+) 7097815-7098288(-) |
| Potential amino acid sequence |
MLPVFIKCGGSNTLFEVLATDSFILIFCDLLELLVKLSSFFRNLGMSKPYT*(+) MVSSTVGSGTLTGWKRLSNAGSFSICFLYSSSVVAPIHFSKSWLRTASFLSFVICLSSLSSSLA SSGTWACRSLTREPASSIKSIALSGRKRSLMY*(+) MLGLSQYASCIHQVWWLQYTFRSPGYGQLHSYLL*(+) MPRFLKKLESLTRSSSKSQKIRMKLSVARTSKSVLEPPHLMNTGSILRKTQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |