Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0477800_circ_g.2 |
| ID in PlantcircBase | osa_circ_037347 |
| Alias | Os_ciR11493 |
| Organism | Oryza sativa |
| Position | chr8: 23563897-23564094 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0477800 |
| Parent gene annotation |
PWWP domain containing protein. (Os08t0477800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0477800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204343434 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23563898-23563913(+) 23563935-23564057(-) 23563940-23564070(-) |
| Potential amino acid sequence |
MLKRENKSAMEAFHEAVKKELSHVNSPCDSTEEAGNLKDAEARE*(+) MLPLHFYSLASASFKLPASSVESQGELTWDSSFLTASWNASIALLFSRFSIFQVASFFSRIAR* (-) MECFHCTFILSLQHLSSCQLLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |