Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0611000_circ_g.3 |
| ID in PlantcircBase | osa_circ_025191 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30978442-30978526 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0610900 |
| Parent gene annotation |
Similar to EDR1. (Os04t0610900-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0610900_circ_g.2 Os04g0611000_circ_g.1 Os04g0611000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0611000-01:1 Os04t0610900-01:1 Os04t0611000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155883333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30978486-30978441(+) 30978523-30978441(+) 30978515-30978520(-) |
| Potential amino acid sequence |
MLDLRRRLRMALDVREPLPSHQQGICWRNARFKASFAHGVRC*(+) MLGSLFRLINKASAGEMLDLRRRLRMALDVREPLPSHQQGICWRNARFKASFAHGVRC*(+) MRKRRLKSSISPADALLMRRKRLPNI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |