Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G32790_circ_g.4 |
| ID in PlantcircBase | ath_circ_005472 |
| Alias | AT1G32790_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 11875443-11875789 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI-full, CIRI2 |
| Parent gene | AT1G32790 |
| Parent gene annotation |
CTC-interacting domain 11 |
| Parent gene strand | - |
| Alternative splicing | AT1G32790_circ_g.1 AT1G32790_circ_g.2 AT1G32790_circ_g.3 AT1G32790_circ_g.5 AT1G32790_circ_g.6 AT1G32790_circ_g.7 AT1G32790_circ_g.8 AT1G32790_circ_g.9 AT1G32790_circ_g.10 AT1G32790_circ_g.11 AT1G32790_circ_g.12 |
| Support reads | 3 |
| Tissues | root, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G32790.2:3 AT1G32790.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.268097421 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11875772-11875445(-) |
| Potential amino acid sequence |
MCARTIYCTNIDKKVTQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEFVMTEDEREMCART IYCTNIDKKVTQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEFVMTEDEREMCARTIYCTN IDKKVTQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEFVMTEDEREMCARTIYCTNIDKKV TQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEFVM(-) |
| Sponge-miRNAs | ath-miR5662 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |