Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018460_circ_g.4 |
ID in PlantcircBase | zma_circ_008842 |
Alias | Zm05circ00141, zma_circ_0002082, GRMZM2G079013_C1 |
Organism | Zea mays |
Position | chr5: 221202380-221202672 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d018460 |
Parent gene annotation |
leunig-related2 |
Parent gene strand | - |
Alternative splicing | Zm00001d018460_circ_g.2 Zm00001d018460_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d018460_T002:1 Zm00001d018460_T008:1 Zm00001d018460_T004:1 Zm00001d018460_T005:1 Zm00001d018460_T009:1 Zm00001d018460_T012:1 Zm00001d018460_T011:1 Zm00001d018460_T010:1 Zm00001d018460_T003:1 Zm00001d018460_T006:1 Zm00001d018460_T007:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.35609583 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
221202569-221202568(+) 221202638-221202662(-) 221202388-221202580(-) |
Potential amino acid sequence |
MIRVSSLKLSMSLMHKLQLLHLHLLLVLSCFYLLCPAWFVADLRRAILLASISCDPSDSIECGC FNRSSYILAAKTLAVDGPKMPSEFKAFIGPLSEG*(+) MQMQQLQLMHQRHAQLQRTNANHPSLNGPINALNSEGILGPSTASVLAAKMYEERLKHPHSMES EGSQLIEASRMALLKSATNHAGHSK*(-) MQGTANKSKRAPAADADAAIATYASKTCSTSAN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |