Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d018460_circ_g.4 |
| ID in PlantcircBase | zma_circ_008842 |
| Alias | Zm05circ00141, zma_circ_0002082, GRMZM2G079013_C1 |
| Organism | Zea mays |
| Position | chr5: 221202380-221202672 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d018460 |
| Parent gene annotation |
leunig-related2 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d018460_circ_g.2 Zm00001d018460_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d018460_T002:1 Zm00001d018460_T008:1 Zm00001d018460_T004:1 Zm00001d018460_T005:1 Zm00001d018460_T009:1 Zm00001d018460_T012:1 Zm00001d018460_T011:1 Zm00001d018460_T010:1 Zm00001d018460_T003:1 Zm00001d018460_T006:1 Zm00001d018460_T007:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.35609583 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
221202569-221202568(+) 221202638-221202662(-) 221202388-221202580(-) |
| Potential amino acid sequence |
MIRVSSLKLSMSLMHKLQLLHLHLLLVLSCFYLLCPAWFVADLRRAILLASISCDPSDSIECGC FNRSSYILAAKTLAVDGPKMPSEFKAFIGPLSEG*(+) MQMQQLQLMHQRHAQLQRTNANHPSLNGPINALNSEGILGPSTASVLAAKMYEERLKHPHSMES EGSQLIEASRMALLKSATNHAGHSK*(-) MQGTANKSKRAPAADADAAIATYASKTCSTSAN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |