Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G070000_circ_g.2 |
| ID in PlantcircBase | gra_circ_000580 |
| Alias | Chr06:28293799|28294840 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 28293799-28294840 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G070000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.006G070000_circ_g.1 |
| Support reads | 15 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G070000.5:4 Gorai.006G070000.2:4 Gorai.006G070000.6:4 Gorai.006G070000.3:4 Gorai.006G070000.1:4 Gorai.006G070000.4:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000350* gar_circ_000193* |
| PMCS | 0.12220092 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28293857-28293807(+) 28294785-28293807(+) |
| Potential amino acid sequence |
MESIPTIVEVSNSNTCELLKSISGLKVEPVENVSSKLFAQCSRQKGLIKIYRHLLNYQKNVFSL HHFPSLTGLTYRQIRQGFQEAVVCGLYRNGRIYFHPGDDEVLQEMDKVWS*(+) MVGYTSTLEMMKFFRKWTKYGVDTDAFLSVLALQPIPKMESIPTIVEVSNSNTCELLKSISGLK VEPVENVSSKLFAQCSRQKGLIKIYRHLLNYQKNVFSLHHFPSLTGLTYRQIRQGFQEAVVCGL YRNGRIYFHPGDDEVLQEMDKVWS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |