Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0585100_circ_g.8 |
ID in PlantcircBase | osa_circ_034576 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 23759037-23760021 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0585100 |
Parent gene annotation |
Mo25-like domain containing protein. (Os07t0585100-01) |
Parent gene strand | + |
Alternative splicing | Os07g0585100_circ_g.4 Os07g0585100_circ_g.5 Os07g0585100_circ_g.6 Os07g0585100_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0585100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.223750694 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23759050-23759056(+) 23759082-23759966(-) |
Potential amino acid sequence |
MLLDRSNSTVMMRYVSSKDNLMILMNLLRDSSKNIQIEAFHVFKLFAANKNKPTEVVNILVTNR SKLLRFFAGFKIDKVLGRHAA*(+) MTVELDLSSSMSPKNFVNLESGKKSEKLASVCD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |