Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0632200_circ_g.3 |
| ID in PlantcircBase | osa_circ_031450 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 25592725-25593040 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0632200 |
| Parent gene annotation |
Similar to tryptophan synthase-related. (Os06t0632200-01);Simila r to tryptophan synthase-related. (Os06t0632200-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0632200-01:1 Os06t0632200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236024842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25592780-25593017(+) |
| Potential amino acid sequence |
MSMNRSSVTSCLISSSGKRGDRSLGFSGWCVCGCSGGGGFTGRSATRLYHCFGMLTGFELALAV KLLLLTEALCFGLQRSEAFSEPAADQRRRAPELVNLGDLLRDVDEPLLGHLLPDQLVGEERGQV TRVQWLVRLRVQRRRWLHRQVGDEVVPLLRDAHRIRAGPGSEASSSDRSSLLWFAKE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |