Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0538000_circ_g.3 |
| ID in PlantcircBase | osa_circ_002070 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 19684450-19684887 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0538000 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0538000-01);Similar to cDN A, clone: J065161O13, full insert sequence. (Os01t0538000-02);Si milar to cDNA, clone: J065161O13, full insert sequence. (Os01t05 38000-03);Similar to cDNA, clone: J065161O13, full insert sequen ce. (Os01t0538000-04) |
| Parent gene strand | + |
| Alternative splicing | Os01g0538000_circ_g.1 Os01g0538000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0538000-01:2 Os01t0538000-04:2 Os01t0538000-02:2 Os01t0538000-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009958 |
| PMCS | 0.134893493 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19684827-19684474(+) 19684665-19684749(-) |
| Potential amino acid sequence |
MSSNLTWGLDMRTTSLLTRHKRSDSTYWT*(+) MPLDMGLVVAEYQTHNQDRSGMEGLGRAFVALHGSCGELQVQYVESDRLCLVRRLVVRISNPQV RLLLIHFLELRLQTSLQLSLLLLQGGFLHL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |