Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0509500_circ_g.1 |
| ID in PlantcircBase | osa_circ_039770 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19775846-19776589 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0509500 |
| Parent gene annotation |
Diacylglycerol acyltransferase domain containing protein. (Os09t 0509500-00) |
| Parent gene strand | - |
| Alternative splicing | Os09g0509500_circ_g.2 Os09g0509500_circ_g.3 Os09g0509500_circ_g.4 Os09g0509500_circ_g.5 Os09g0509500_circ_g.6 Os09g0509500_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0509500-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133175773 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19776509-19775877(+) 19776543-19776578(-) |
| Potential amino acid sequence |
MVLLLLQTLMPSSQIQTALAKTTYTPLPLVSIGFPKMK*(+) MASRFGATIIPFGVVGEDDICDMLLDYDDLMKIPFYDILDRMLNEDGVKLRTDSTGELKYQRIH PVVAAPKIPGRFYFIFGKPIETRGRGV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |