Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G139600_circ_g.2 |
| ID in PlantcircBase | gra_circ_001402 |
| Alias | Chr13:37586306|37587539 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 37586306-37587539 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G139600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.013G139600_circ_g.1 |
| Support reads | 5/6 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G139600.2:2 Gorai.013G139600.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000443 |
| PMCS | 1.1000755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37587496-37587512(-) |
| Potential amino acid sequence |
MDGAKETGLRNVSSTCSISESDDYDLSRLLDKPRLNIERQRSFDERSLGELSIGLTRGAHDNYE TTHSPGWRSGFNTPASSARNSFEPHPMVADAWEALRRSLVYFKGQPVGTIAAYDHASEEVLNYD QVFVRDFVPSALAFLMNGEPEIVKNFLVKTLHLQGWEKRIDRFKLGEGAMPASFKVLHDPVRKS DTIIADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLSLAETPECQKGMRLILTLCLSEGFDT FPTLLCADGCSMIDRRMISSSETGFC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |