Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0687900_circ_g.2 |
ID in PlantcircBase | osa_circ_016001 |
Alias | Os_ciR7989 |
Organism | Oryza sativa |
Position | chr2: 28215894-28216546 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os02g0688000 |
Parent gene annotation |
Hypothetical protein. (Os02t0688000-00) |
Parent gene strand | - |
Alternative splicing | Os02g0687900_circ_g.1 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0687900-01:3 Os02t0687900-01:3 Os02t0688000-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242389663 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28215973-28215994(-) |
Potential amino acid sequence |
MAFYAAWKITCVRKTRRAPYPFRHRSLYCRKGQVVSILDCEFNPAAWPSRCHALQSSTMEKFND LIHACVPENGTIGSWSPLYTRAR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |