Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0687900_circ_g.2 |
| ID in PlantcircBase | osa_circ_016001 |
| Alias | Os_ciR7989 |
| Organism | Oryza sativa |
| Position | chr2: 28215894-28216546 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0688000 |
| Parent gene annotation |
Hypothetical protein. (Os02t0688000-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0687900_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0687900-01:3 Os02t0687900-01:3 Os02t0688000-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242389663 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28215973-28215994(-) |
| Potential amino acid sequence |
MAFYAAWKITCVRKTRRAPYPFRHRSLYCRKGQVVSILDCEFNPAAWPSRCHALQSSTMEKFND LIHACVPENGTIGSWSPLYTRAR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |