Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0294600_circ_g.4 |
ID in PlantcircBase | osa_circ_009112 |
Alias | Os_ciR3631 |
Organism | Oryza sativa |
Position | chr11: 10787816-10789989 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os11g0294600 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os11 t0294600-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os11t0294600-02) |
Parent gene strand | - |
Alternative splicing | Os11g0294600_circ_g.2 Os11g0294600_circ_g.3 |
Support reads | 2/5 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0294600-01:4 Os11t0294600-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009547 |
PMCS | 0.326561465 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10789914-10789935(-) |
Potential amino acid sequence |
MGGCCCCSSRGSETDRAPVHIYRQQNQEEHEPLSSAYDGSSPASAIVAVDTNLDTSTPDTYRAP PAPLPYDVSLPVPENPDLEKSDLKSKTDDQQEESLEVDEFKSCEKCVAEDKPDEEDVCPICLEE YDAENPRSLTKCEHHFHLCCILEWMERSDTCPVCDQGYERRNFSFKRQLFHSLE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |