Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0294600_circ_g.4 |
| ID in PlantcircBase | osa_circ_009112 |
| Alias | Os_ciR3631 |
| Organism | Oryza sativa |
| Position | chr11: 10787816-10789989 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os11g0294600 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os11 t0294600-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os11t0294600-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0294600_circ_g.2 Os11g0294600_circ_g.3 |
| Support reads | 2/5 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0294600-01:4 Os11t0294600-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009547 |
| PMCS | 0.326561465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10789914-10789935(-) |
| Potential amino acid sequence |
MGGCCCCSSRGSETDRAPVHIYRQQNQEEHEPLSSAYDGSSPASAIVAVDTNLDTSTPDTYRAP PAPLPYDVSLPVPENPDLEKSDLKSKTDDQQEESLEVDEFKSCEKCVAEDKPDEEDVCPICLEE YDAENPRSLTKCEHHFHLCCILEWMERSDTCPVCDQGYERRNFSFKRQLFHSLE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |