Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0908200_circ_g.7 |
| ID in PlantcircBase | osa_circ_005357 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 39547655-39547962 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os01g0908200 |
| Parent gene annotation |
Member of the Bric-a-Brac/Tramtrack/Broad (BTB) family, BT1/BT2 ortholog, Negative regulation of nitrate uptake and nitrogen use efficiency (Os01t0908200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11/17 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0908200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.420652408 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39547719-39547706(+) |
| Potential amino acid sequence |
MDCLSHICTEGCTEVGPVGRAPAAAPCPAYATACRGLQLLIRHFSRCHRTSCPRCQRMWQLLRL HAALCDLPDGHCNTPLCIGGGSGGGRGRSKGSTWS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |