Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G01110_circ_g.1 |
ID in PlantcircBase | ath_circ_000021 |
Alias | Ath_circ_FC2512 |
Organism | Arabidpsis thaliana |
Position | chr1: 52938-53183 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G01110 |
Parent gene annotation |
IQ-domain 18 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G01110.1:1 AT1G01110.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.268428895 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53022-53180(+) |
Potential amino acid sequence |
MTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSMARRALRALKG LVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYLQ DLSDRQSMARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQSRVLDQRKRLSHDGS RKSAFSDSHAVFESRYLQDLSDRQSMARRALRALKGLVKLQALVRGHNVRKQAKMTLRCMQALV RVQSRVLDQRKRLSHDGSRKSAFSDSHAVFESRYLQDLSDRQSM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |