Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0617200_circ_g.9 |
ID in PlantcircBase | osa_circ_002642 |
Alias | Os_ciR5082 |
Organism | Oryza sativa |
Position | chr1: 24502989-24503240 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0616900 |
Parent gene annotation |
Ctps protein. (Os01t0616900-00) |
Parent gene strand | - |
Alternative splicing | Os01g0617200_circ_g.1 Os01g0617200_circ_g.2 Os01g0617200_circ_g.3 Os01g0617200_circ_g.4 Os01g0617200_circ_g.5 Os01g0617200_circ_g.6 Os01g0617200_circ_g.7 Os01g0617200_circ_g.8 |
Support reads | 3/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0617200-00:2 Os01t0617200-00:2 Os01t0616900-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.38933125 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24503213-24503029(-) |
Potential amino acid sequence |
MSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQILTLTQMLGPCPRSNMVR FLCLMMVARWTWILGITRGFLTLN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |