Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G51070_circ_g.7 |
ID in PlantcircBase | ath_circ_043555 |
Alias | At_ciR926 |
Organism | Arabidpsis thaliana |
Position | chr5: 20765823-20766152 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT5G51070 |
Parent gene annotation |
Chaperone protein ClpD, chloroplastic |
Parent gene strand | + |
Alternative splicing | AT5G51070_circ_g.2 AT5G51070_circ_g.3 AT5G51070_circ_g.4 AT5G51070_circ_g.5 AT5G51070_circ_g.6 AT5G51070_circ_g.8 AT5G51070_circ_g.9 AT5G51070_circ_g.10 AT5G51070_circ_g.11 AT5G51070_circ_g.12 |
Support reads | 7 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G51070.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.204359849 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20765835-20766149(+) |
Potential amino acid sequence |
MSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIAN LLKPSLGRGELQTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGS GTVGRGNKGSGLDIANLLKPSLGRGELQTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKS GKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKPSLGRGELQTKRIMSLDIGLLMAGAKERG ELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKPSLGRGELQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |