Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G51070_circ_g.7 |
| ID in PlantcircBase | ath_circ_043555 |
| Alias | At_ciR926 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 20765823-20766152 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT5G51070 |
| Parent gene annotation |
Chaperone protein ClpD, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT5G51070_circ_g.2 AT5G51070_circ_g.3 AT5G51070_circ_g.4 AT5G51070_circ_g.5 AT5G51070_circ_g.6 AT5G51070_circ_g.8 AT5G51070_circ_g.9 AT5G51070_circ_g.10 AT5G51070_circ_g.11 AT5G51070_circ_g.12 |
| Support reads | 7 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G51070.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204359849 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20765835-20766149(+) |
| Potential amino acid sequence |
MSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIAN LLKPSLGRGELQTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKSGKVILFIDEVHTLIGS GTVGRGNKGSGLDIANLLKPSLGRGELQTKRIMSLDIGLLMAGAKERGELEARVTALISEVKKS GKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKPSLGRGELQTKRIMSLDIGLLMAGAKERG ELEARVTALISEVKKSGKVILFIDEVHTLIGSGTVGRGNKGSGLDIANLLKPSLGRGELQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |