Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0424000_circ_g.1 |
ID in PlantcircBase | osa_circ_027961 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 20779394-20779627 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0424000 |
Parent gene annotation |
Amino acid permease, Transport of amino acids (Os05t0424000-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0424100-00:1 Os05t0424100-00:1 Os05t0424000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006793* |
PMCS | 0.333325107 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20779507-20779601(-) |
Potential amino acid sequence |
MTAGPATQPSCAIAHPSDSTPEPITAVMMCALAVHIVLRLAFTASM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |