Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0531100_circ_g.3 |
ID in PlantcircBase | osa_circ_039955 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20800755-20802025 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os09g0531100 |
Parent gene annotation |
Conserved hypothetical protein. (Os09t0531100-01) |
Parent gene strand | - |
Alternative splicing | Os09g0531100_circ_g.2 |
Support reads | 1 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0531100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018680 osi_circ_008197* |
PMCS | 0.159875616 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20801948-20802004(-) |
Potential amino acid sequence |
MLRDANPRELDQIVVENVLAFDEGFWVRLAARIDLCKSDDDKKDYEELAENVMNIVDRLVHKTD EKIEQSTDVLKAIISPVMHEGENATWPPRDPEALKLMEKEDFVICN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |