Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G34680_circ_g.14 |
ID in PlantcircBase | ath_circ_016483 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 14626660-14627037 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G34680 |
Parent gene annotation |
Outer arm dynein light chain 1 protein |
Parent gene strand | - |
Alternative splicing | AT2G34680_circ_g.11 AT2G34680_circ_g.12 AT2G34680_circ_g.13 |
Support reads | 1 |
Tissues | inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G34680.1:3 AT2G34680.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.393573313 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14626819-14626662(-) |
Potential amino acid sequence |
MLQQLYLAGNQITSLASLPQLPNLEFVYLRDNLLSTLEGIEILNRVKVLDLSFNDFKGPGFEPL ENCKMLQQLYLAGNQITSLASLPQLPNLEFVYLRDNLLSTLEGIEILNRVKVLDLSFNDFKGPG FEPLENCKMLQQLYLAGNQITSLASLPQLPNLEFVYLRDNLLSTLEGIEILNRVKVLDLSFNDF KGPGFEPLENCKMLQQLYLAGNQITSLASLPQLPNLE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |