Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.009G337600_circ_g.1 |
| ID in PlantcircBase | gra_circ_001014 |
| Alias | Chr09:37044969|37045364 |
| Organism | Gossypium raimondii |
| Position | chrChr09: 37044969-37045364 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.009G337600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/12 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.009G337600.3:2 Gorai.009G337600.1:2 Gorai.009G337600.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000124* ghi_circ_000074* |
| PMCS | 0.955394992 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37045348-37045331(-) |
| Potential amino acid sequence |
MEGKRISLDTPRNGKSKVLDPAFSAFLVQLPCKLQNCLKSQLKRLAKDGDRIKPLNSFLEKKNG SSSGLGINLEKQLQAWRENPSWVNPPPEIEISQVRIWKGKE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |